Bioinformatics: From Genome Sequences to Protein Structures

Structure prediction

Page 4 of 5

d. Prediction of transmembrane spanning regions

One possibility you need to consider when you have a mystery sequence, particularly if it fails to match any protein of known structure or function, is whether it might be a membrane protein.

There are several types, here numbered 1-5:-

  1. Partially inserted into the membrane (eg mellitin - 2mlt ).
  2. A hydrophilic domain at each end of the protein with a single hydrophobic domain spanning the whole membrane.
  3. Peripheral proteins (eg cytochrome c 3cyt ) which are not inserted into the membrane but which bind to it, principally by ionic associations with the polar phospholipid heads or with other membrane proteins.
  4. The polypeptide chain may traverse the membrane several times and the protein may have a pore running through it to act as a transmembrane channel or ion pump (see below).
  5. Another type of peripheral protein associates with the membrane by means of a covalent attachment to a glycolipid in the bilayer.
Adapted from the PPS2 course (1996)

In all the above examples, the regions of the protein that are within the membrane, and which interact with the membrane's lipid bilayer, have to primarily consist of hydrophobic residues due to the bilayer's hydrophobic character. The regions outside the membrane, which are exposed to the aqueous solution, have a surface polarity comparable to that of soluble proteins. The interior of a membrane protein can also be very polar as is the case, for example, for channel proteins.

Here we are concerned with proteins of type 4 - those with membrane spanning regions which have a characteristic pattern of hydrophobic and polar regions.

They fall into two categories: alpha-helical bundles and beta-barrels:-

Bacteriorhodopsin
(alpha-helical bundle)
Matrix porin
(beta-barrel)
PDB code: 1ap9 PDB code: 1opf

To span the membrane, the alpha-helices need to be around 20 residues in length, and the beta strands around 12.

The polypeptide chain alternately passes from the outside of the cell to the inside and then back again:-

Methods which try to predict the transmembrane-spanning regions of a given protein sequence rely on identifying these characteristic patterns of hydrophobic and polar residues, specifically in transmembrane helices. Given a sequence that is known to be that of a membrane protein, the prediction of transmembrane helices can reach accuracies of 95% (Rost et al., 1995 ), while the fraction of false positives (ie globular proteins predicted as having one or more transmembrane helices) is about 2% (Rost et al., 1996 ).

Let's try to see what one such prediction method gives for our mystery protein. Here's the sequence again:-

AEIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYL
QMGQEVPVKVLEVDRQGRIRLSIKEATEQSQPAA

Paste the sequence into the large box and click on the "Run TMpred " button.

This will give you a list of possible transmembrane helices and a model of how the protein might sit in the membrane.

Are there any TM helices?
Number of helices?

Now compare the prediction with the secondary structure predictions from Jpred.

Do the predictions agree or conflict?

Predicting a known membrane protein

Let's have a look at the TMpred prediction for a genuine membrane protein. Run the prediction for the bacteriorhodopsin sequence:-

XXXXXXRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSM
LLGYGLTMVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIG
TGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKAESMRPEVASTFKVLRNVTVV
LWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLR

How many helices are given by the strongly preferred model?

Let's see how well the prediction did:

  1. Go to the PDB page for 1ap9 which gives the 3D structure of this protein. You may download the PDB file by clicking with the right mouse button here (and choosing "save target as" or "save link as" - depending on the browser you use). Load the file into Rasmol/SwissPDBviewer and color the helix-stretches TMPRED predicted one by one

You should get something that looks like:

How well do you think the prediction has done?

Compare the scores given for each of the predicted transmembrane helices with those we got for our mystery protein sequence above.


Carry on HERE.

This material is prepared with the support of the project ESF pro V� II na UK, Reg. num.: CZ.02.2.69/0.0/0.0/18_056/0013322.